SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013822 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013822
Domain Number 1 Region: 590-832
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-45
Family Protein kinases, catalytic subunit 0.0000178
Further Details:      
 
Domain Number 2 Region: 336-388
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000401
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013822   Gene: ENSEEUG00000015126   Transcript: ENSEEUT00000015148
Sequence length 916
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4470:131:106325:1 gene:ENSEEUG00000015126 transcript:ENSEEUT00000015148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRAAPRAAAMGEEKEGGRAGAADGGAGAEASRALQQCGQLQKLIDISIGSLRGLRTKCS
VSNDLTQQEIRTLETKLVRYICKQRQCRLSVAPDKRTSELNSYPRFSDWLYTFNVRPEVV
QXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEHKEHSGW
GSLDARRETGSTPSLDTLSSASLHWPQGSSPMGRLGSSAQGPRSVSVSALPASDSPAPGP
SEGCSDTCLPLHASGRLTPRALHNFITPPTTPQLRRHTKPKPPRTPPPPSRKVFQLLPSF
PTLTRSKSHESQLGNRIDDVSPMRFDLPHGSPQMVRRDIGLSVTHRFSTKSWLSQVCHVC
QKSMMFGVKCKHCRLKCHNKCTKEAPACRISFLPLPRLRRTESVPSDINNPVDRAAEPHF
GTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFLTSSNPSSATTPPNPSPGQRD
SRFNFPAAYFIHHRQQFIFPVPSDGFHKKCLLSAESKKNKFHISAFPQPPPDAADSNTRL
DDQTKVDVLEDHEVEXXXXXXXXXXAEDDEDELDDLPSSRRTRGPISRKASQTSVYLQEW
DIPFEQVELGEPIGQGRWRVHRGRWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHE
NVVLFMGACMNPPHLAIITSFCKGRTLYSFVRDPKISLDINKTRQIAQEIIKGMGYLHAK
GIVHKDLKSKNVFYDNGKVVITDFGLFGMSGVVREGRRENQLKLSHDWLCYLAPEIVREM
TPGKDEDQLPFSKAADVYAFGTVWYELQARDWPFKNQAAEALIWQIGSGEGMKRVLASVS
LGKEVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINSSKVVPR
FERFGLGVLESSNPKM
Download sequence
Identical sequences ENSEEUP00000013822 ENSEEUP00000013822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]