SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013836 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013836
Domain Number 1 Region: 148-353
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.84e-64
Family Arfaptin, Rac-binding fragment 0.0012
Further Details:      
 
Domain Number 2 Region: 51-100
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000184
Family PDZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013836   Gene: ENSEEUG00000015159   Transcript: ENSEEUT00000015162
Sequence length 416
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1319:635:14538:1 gene:ENSEEUG00000015159 transcript:ENSEEUT00000015162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSDLDYDIEEDKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFDNTPAAL
DGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKK
VKHRLVXXXXXXXXXXXXXXXXXXXXXGLVKRLEELERTAELYKGMTEHTKNLLRAFYEL
SQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLN
KAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
RQEARTRFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFPI
EVDLAHTTLAYGLSQEEFTDGEEEEEEEEDTAAREPPRDARGAAGPLDKGGSWSDS
Download sequence
Identical sequences ENSEEUP00000013836 ENSEEUP00000013836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]