SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013840 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013840
Domain Number 1 Region: 663-880
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 201-470
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-29
Family FCH domain 0.053
Further Details:      
 
Domain Number 3 Region: 598-655
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000553
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013840   Gene: ENSEEUG00000015139   Transcript: ENSEEUT00000015166
Sequence length 1135
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4188:40237:111835:-1 gene:ENSEEUG00000015139 transcript:ENSEEUT00000015166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAHKKKKAKKKHVLASGQLSTDTTKMGDGPINTTFIFDPNYIKELIHDVRALSSMLLCL
KDAIVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNFTEVNE
ENKNDLFGEVFSSVEKLALTLGNNLTNLLMGDITNGSMIQQTISQESKTFENISMESMDS
HIEKGNFSPLELENILLKNTDSVELALTYAKTWSKYTKNIISWVEKKLNLEFESMRNLVK
LAETTRSSIELQEFMPLRVLFTNALLNDVENSQHVQRAIESLQTNKFVQPLLGRKNEMEK
QRKTFKELWKQEQHKMLESETALKKAKLLCMQRQEEYEKAKSSMFRAEEEHLYSSGGGLK
SINKQLEKKRRLEEEALQKVEEANDLYKVCMTSVEDRRNDLENTKREILTQLQKIIYQCD
LTLKAVTVNFFQIQQQQAASLASQMQSFFCNAKQYDPGREYNDFIVTTNSAEEKTFIRNV
NKQLTDSSCTSGYQPSNSLEGVMHLPDTSKVEDDNCTDATXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDFHRKLPRTPSSGTMSSAEDLDDREIPSPSEAGPNSLGLFKKTL
MSKAALTHKFRKLRSPSKCRDCEGIVVFQGLECEECLLGCHKKCLENLVIICGHQKLLGK
IHLFGAEFTSFAKKEPDGIPFVLKLCISEIENKALCLQGIYRISGNKARMDKLCQALENG
HHHVDLSEFSSHDISDVLKLYLRQLPEPFILFRLYNEFIALAKEIQLVNEDQETKKDDTE
EKKKAHNSVEINRILVKSKDLLRQLPVLNFNSFHFLILHLKRVADRCHENEISRNIGLIF
GPILFRTKVLKVSITNFPLLEYANEEILLEFILIYSDRIFDKALQPTKPLFTPEVRELLD
ASKLLFFFSKNGDNFVDSKNTIFQQPMSVEKPENKQDTLEEYNKCPTAKSNKGHNSRIKR
SVSLPVDKLLFANHPSKRNGRDMAKVNSDKFGRNPVLEEINRKDSPTIVCSKFDDFALPT
IQKTREKEFEQGDPAAKTAVAXSIRVSGDPPASATLHSKPHTEPVRSGRQVSERRSSDSC
PLAPVRAPRTLQPQHWTTFYKPHAPTGGVRGGGKKTLTPPPTIVLPGTNCAPQGL
Download sequence
Identical sequences ENSEEUP00000013840 ENSEEUP00000013840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]