SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013867 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013867
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.37e-57
Family IMD domain 0.0000558
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000013867
Domain Number - Region: 357-395
Classification Level Classification E-value
Superfamily SH3-domain 0.0329
Family SH3-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013867   Gene: ENSEEUG00000015187   Transcript: ENSEEUT00000015194
Sequence length 511
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1319:24095:45235:-1 gene:ENSEEUG00000015187 transcript:ENSEEUT00000015194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SIMEQFNPALENLVYLGNNYLRAFHALSEAAEVYFTAIQKIGEQALQSSTSQILGEILVQ
MSDTQRHLNSDLEVVVQIFHGDLLQHMEKNTKLDMQFIKDSRQHYEMEYRHRAANLDKCM
SELWRMERKRDKNAREMKESVNRLHAQMQAFVSESQRAAELEEKRRYRFLAEKHLLLSNT
FLQFFGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGWF
PEAYVKPLEEAAVNPMTPLSPMTSINPMNPVNPMSPVNELTSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFMSWEQN
PPELFPKGTNPFATVKLRPTVTNDRSAPLIR
Download sequence
Identical sequences ENSEEUP00000013867 ENSEEUP00000013867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]