SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013870 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013870
Domain Number 1 Region: 78-291
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-78
Family SSRP1-like 0.00000896
Further Details:      
 
Domain Number 2 Region: 423-503
Classification Level Classification E-value
Superfamily HMG-box 1.57e-25
Family HMG-box 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013870   Gene: ENSEEUG00000015192   Transcript: ENSEEUT00000015197
Sequence length 521
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5070:6:5821:-1 gene:ENSEEUG00000015192 transcript:ENSEEUT00000015197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLLSFDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVD
PVEAFAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPY
TTVLRLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEK
RFEGRLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLE
RGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXFDSNASASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPT
EMKKGKDPNAPKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEW
DRKAEDARRDYEKAMKEYEGGRGESSKRDKSKKKKKVKAKV
Download sequence
Identical sequences ENSEEUP00000013870 ENSEEUP00000013870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]