SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013878 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013878
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.78e-21
Family IMD domain 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013878   Gene: ENSEEUG00000015207   Transcript: ENSEEUT00000015205
Sequence length 349
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_9025:337:6046:1 gene:ENSEEUG00000015207 transcript:ENSEEUT00000015205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIDAISNKQGELEGYVSDGYKTALTEERRRFCFLVEKQCAVAKSSAAYHSKGKDLLAQKL
PLWQQACADPNKIPERAVQLMQQVASSNGSILPSTLSTSKSNLVISDPIPGAKPLPVPPE
LAPFVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQQGKSSSTGNLLDKD
DLALPPPDYGTSSRAFPGQMAGTFKQRPYSVAVPAFSQGLDDYGPRAVS
Download sequence
Identical sequences ENSEEUP00000013878 ENSEEUP00000013878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]