SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013912 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013912
Domain Number 1 Region: 28-155
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.84e-44
Family Regulator of G-protein signaling, RGS 0.000000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013912   Gene: ENSEEUG00000015252   Transcript: ENSEEUT00000015241
Sequence length 166
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_362346:3971:4629:-1 gene:ENSEEUG00000015252 transcript:ENSEEUT00000015241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NEERRRAWRASRESKLQPLPSCEACAPPSPEKCKSLAQSFDKLMHSPAGRSAFREFLRTE
YSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQE
PSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLRGGSQSSNEA
Download sequence
Identical sequences ENSEEUP00000013912 ENSEEUP00000013912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]