SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013915 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013915
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily PX domain 6.67e-25
Family PX domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013915   Gene: ENSEEUG00000015256   Transcript: ENSEEUT00000015246
Sequence length 108
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2313:8960:16670:-1 gene:ENSEEUG00000015256 transcript:ENSEEUT00000015246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDSF
IEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRHA
Download sequence
Identical sequences ENSEEUP00000013915 ENSEEUP00000013915 XP_008579988.1.73410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]