SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013965 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013965
Domain Number 1 Region: 345-503
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-20
Family Pleckstrin-homology domain (PH domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 94-133,172-243
Classification Level Classification E-value
Superfamily PH domain-like 0.000003
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013965   Gene: ENSEEUG00000015285   Transcript: ENSEEUT00000015302
Sequence length 764
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7149:307196:384134:1 gene:ENSEEUG00000015285 transcript:ENSEEUT00000015302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEQLLPELTGLLSLLDHEYLSDTTLQKKMAVASILQNLQPLPAKEVSYLYVNTSDLHSGP
SFVESLFEEFDCDLSDLRDLPEDESEPSKGASPEPAKSPALRNATDLPPPLPNRPPPEDY
YEEALPLGPGKAPEYISSHNGSSPAHSIMDAYYEDADSSYPATXXXXXXXXXXNDSDAMS
SSYESYDDDEEEGKGPQPTHQWPSEEASMHLVRDCRICAFLLRKKRFGQWAKQLTVIKED
QLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXSKTTGGAERVYGATPRSPILLCKLDLDKRLSQEKQASDSDSLGMGDNCSTLG
RREACEHGKGKKSSLAELKGSMSRAAGRKITRIISFSKKKALADELQTSSAEEEVPCCGY
LNVLVNHSWKERWCRLKCNTLYFHKDRTDLRTHINAIALQGCEVAPGFGPRHPFAFRILR
NRQEVAILEASCSEDMGRWLGLLLVEMGSRVTPEALHYDYVDVETLTSIVSAGRNSFLYA
RSCQDQWPEPRVYDDVPYEKMQDEEPERPTGAQVKRHASSCSEKSHRMDPQVKVKRHASS
ANQYKYGKNRAEEDARRYLVEKEKLEKEKETIRSELMALRQEKRELKEAIRSNAGTKSKD
LEETMATLEAQCRAKEERRIDLELRLVAVKERLQQSLAGGPALGLSVSSKSKSGETATKP
QGNTSEQPLPVNCVSELRKRSPSIVTSNQGRVLQKAKEWEMKKT
Download sequence
Identical sequences ENSEEUP00000013965 ENSEEUP00000013965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]