SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013970 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000013970
Domain Number - Region: 84-131
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00011
Family Pyk2-associated protein beta ARF-GAP domain 0.013
Further Details:      
 
Domain Number - Region: 19-39
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0445
Family Pyk2-associated protein beta ARF-GAP domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013970   Gene: ENSEEUG00000015305   Transcript: ENSEEUT00000015308
Sequence length 468
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2306:286:71026:1 gene:ENSEEUG00000015305 transcript:ENSEEUT00000015308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAVAIANISSSDPPLQPLVSSPSLQAAAEKNKLEKEKEKKKEEKKREKE
PEKPTKPLTTEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPAEAPVTNGSITTVPAL
NDDLDIFGPMISNPLPSTVMPPAQGTSSVPAATTLSTVTSEDLDLFSEQTTKSEEVAKKQ
LSKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPPAFQGFPSIGVPVPAAPGLMGNM
MGQSASMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQLSAPQSKFGLPQGQQPQW
NLPQMNQQMAGMNISSTNPTVGFGQPPNTTAGWSGSSSGQTLSTQLWK
Download sequence
Identical sequences ENSEEUP00000013970 ENSEEUP00000013970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]