SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013978 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013978
Domain Number 1 Region: 306-443
Classification Level Classification E-value
Superfamily Ras GEF 7.19e-22
Family Ras GEF 0.017
Further Details:      
 
Domain Number 2 Region: 512-575
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000593
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0067
Further Details:      
 
Domain Number 3 Region: 455-518
Classification Level Classification E-value
Superfamily EF-hand 0.00000774
Family Polcalcin 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013978   Gene: ENSEEUG00000015298   Transcript: ENSEEUT00000015317
Sequence length 656
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3471:10797:30961:-1 gene:ENSEEUG00000015298 transcript:ENSEEUT00000015317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKSGSRAQPRQACRHKTSPSPREISKVMASMALGMLNETSCSEDELLEKCIQSFDSAGSL
RRGDHILNMVLAMHSWVLPSTQLAGRLLTLYPPGATGNTQELRRLQICHLVXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXALLELTELLGSRNNYARYRRTWAGCTGFPLPVLGVHLKDLVSLHEAQPDRVPDGRL
HLPQLNSLLRLQELGALQRQQLPCSANELLHLLTLSLDLFYTEDEIYKLSYSREPRCPKS
LPPSPFKMPLVVEWAPGVTPKPDRVTLGRHVKQLVESVFKNYDTDGRGTISLEDFERLSA
SFPFACHGLHPPLRQGSGAFSREELTDYMLRASAICSKLGLASLHNFHEVSFRKPTFCDS
CSGFXXXXXXXXXXXXXCGLCCHKHCRDRVKAECKKPGSKDDGSSPRASTPPLLVPHANC
GSEDSLPYTLPQDSETECYPHQASTQQEPSHLSWEPETVPLPAAAPPPTQPSKLNS
Download sequence
Identical sequences ENSEEUP00000013978 ENSEEUP00000013978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]