SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000013989 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000013989
Domain Number 1 Region: 163-265
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000957
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000013989   Gene: ENSEEUG00000015303   Transcript: ENSEEUT00000015329
Sequence length 1102
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7285:19200:321454:-1 gene:ENSEEUG00000015303 transcript:ENSEEUT00000015329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHWTYGVCRNSVFFIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XHNQQTTAFRHPVSGQFSPENSEFILQEEPNPHMLKQERSQRPSSMVSETSIAGTSSTVE
AKPGPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSSGMRLWKRRWFVLADYC
LFYYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAVHTGMRALISSGPQTELSGM
RTYYFSADTLEDMNVWVRAMNQAAQVLSRSSLKRDMEKVERHAVPQANHAESCRECGRVG
PGHARDCSHHRSHEDSFGFERREQRQRNYYDHLDRSKARSPYSPAEDDALFVDPPGSLRG
QQAQPQWAEKNGTLPGTYGPGEQNGTGGFPRAYPLRTNPEKHSQRKSNLAQVEHWSKAQK
GDGRSLPLDQTLPRQGPSQSLSFPESYQTLPKSTRHPSGSSSPPPRNLPSDYKYAQDRAS
HLKMSSEERRAHRDGTVWQLYEWQQRQQFRHGSPTAPICSGSPDFTDQGRSRSMLEVPRS
ISVPPSPSDIPPPGPPRAFPTRRPHTPAERVTVIPSDQRRSVDISLGSSPRKAHGHTAKN
SSHVDRRSMPSMGYMTHTVSAPSLHGKSADDTYLQLKKDLEYLDLKMTGRDLLKDRSLKP
VKIAESDTDVKLSIFCEQDRILQDLEDKIRALKENKDQLESVLEVLHRQMEQYREQPQHL
EKIASQQRLLQEDLVHIRAELSRESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
EKSQIQKDLWRIEDVIAGLSANKENFRILVDSVKNPERKTVPLFPHPPVPSLASLTSESK
PPPQPSPPTSPVRTPLEVRLFPQLQTYVPYRPHPPQLRKVTSPLQSPTKMKPRVEDEAPP
RPPLPELYSPEDQPPAVPPLPREATVIRHTSVRGLKRQSDERKRDREQGQCVNGDSRGEL
RSYVSEPELTTFSGDTTQPSLGLTGTESRYQTLPGRGLSGSTSRLQQPSTIAPYVTLRRG
GNTESSKVTFPFPRPKSALERLYSGDHQRGKMSAEEQLERMKRHQKALVRERKKTLSQGE
RAGLPSSRYLGQPLPGDLGSVC
Download sequence
Identical sequences ENSEEUP00000013989 ENSEEUP00000013989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]