SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014020 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014020
Domain Number 1 Region: 57-194
Classification Level Classification E-value
Superfamily PH domain-like 0.00000812
Family Phosphotyrosine-binding domain (PTB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014020   Gene: ENSEEUG00000015370   Transcript: ENSEEUT00000015364
Sequence length 200
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5222:239660:259552:-1 gene:ENSEEUG00000015370 transcript:ENSEEUT00000015364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKXXXXXXXXXXXXXXXXXXXXXXXXXXXQSNNNLDTC
AEFRIKYVGAIEKLKLSEGKSLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLASEKS
Download sequence
Identical sequences ENSEEUP00000014020 ENSEEUP00000014020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]