SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014164 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014164
Domain Number 1 Region: 215-331
Classification Level Classification E-value
Superfamily PH domain-like 2e-32
Family Third domain of FERM 0.00016
Further Details:      
 
Domain Number 2 Region: 106-217
Classification Level Classification E-value
Superfamily Second domain of FERM 2.75e-20
Family Second domain of FERM 0.00082
Further Details:      
 
Domain Number 3 Region: 509-598
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.00012
Further Details:      
 
Domain Number 4 Region: 28-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-17
Family First domain of FERM 0.0025
Further Details:      
 
Domain Number 5 Region: 629-705
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000000033
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0047
Further Details:      
 
Domain Number 6 Region: 845-888
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.000000000575
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014164   Gene: ENSEEUG00000015499   Transcript: ENSEEUT00000015519
Sequence length 889
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_662:4157:92897:-1 gene:ENSEEUG00000015499 transcript:ENSEEUT00000015519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRVSNSRSSDVPREKTRSEVLCSIRCLDGLVQSFKVNKQDAGQVLLDMAYS
RLGVTEKEYFGLQLGDDSADCPRWLESSKPIRKQLKAGLPCVLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDIREGXXXXXXXXXXXXXXXXXXXHFGDYSSSIHHPGYLAGSQFIPDQ
SDDFSAKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGVASAG
IAVYRRYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQSKKLLPQEKNVLSQYWTLGSRNPKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPKSLPFCPPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
SPRDSDSEVSHNRSPHRESISENNPAQSCLTQKSSSSVSPSSNAPGSCSPDGMDQQFLDD
FRRVTKAGSSEDSSQYYCDKNDSLGDGYLVLIRITPDEDGKFGFNLKGGVDQKIPLVVSR
INPESPADTCIPKLKEGDQIVLINGRDISEHTHDQVVMFIKASRESHTRELALVIRRRAA
CSFSDSKSEDELNQLFPEAIFPVCPEGRDSLEESMEKLKKGLASGTVLIQFEKIFKKKPA
WVFSSAIRPRNFGQNPYIDVLPYDTTRVFLQGNEDYINASYVNXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXAGIGRTGVLVTMETAMCLIERNMPVYPLDIIRKMRDQRAMMVQTS
Download sequence
Identical sequences ENSEEUP00000014164 ENSEEUP00000014164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]