SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014279 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014279
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.36e-79
Family BAR domain 0.00000000142
Further Details:      
 
Domain Number 2 Region: 287-347
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-23
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014279   Gene: ENSEEUG00000015643   Transcript: ENSEEUT00000015642
Sequence length 352
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1941:197:81477:1 gene:ENSEEUG00000015643 transcript:ENSEEUT00000015642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQP
NPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGDVGEA
MRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPD
EELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRL
EERIRQASSQPRREYQPKPRMSLEFPAGDSIQGNGGLSHTGTPQTXXVPMDQPCCRALYD
FEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
Download sequence
Identical sequences ENSEEUP00000014279 ENSEEUP00000014279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]