SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014292 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014292
Domain Number 1 Region: 4-168
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-52
Family Pleckstrin-homology domain (PH domain) 0.0000000351
Further Details:      
 
Domain Number 2 Region: 383-548
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.71e-47
Family Protein kinases, catalytic subunit 0.000000125
Further Details:      
 
Domain Number 3 Region: 247-367,395-421
Classification Level Classification E-value
Superfamily SH2 domain 5.27e-31
Family SH2 domain 0.0001
Further Details:      
 
Domain Number 4 Region: 201-255
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000584
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014292   Gene: ENSEEUG00000015649   Transcript: ENSEEUT00000015655
Sequence length 659
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_151:1102:42797:-1 gene:ENSEEUG00000015649 transcript:ENSEEUT00000015655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQILRRGEEASEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAQVSTSELKKVVALYDYMPMNANDLQLRKGEA
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSIGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAXXXXXXXXXXXXXXXXXXXXXXXXXXSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIAEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKADERPTFKILLSNILDVMDEES
Download sequence
Identical sequences ENSEEUP00000014292 ENSEEUP00000014292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]