SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014294 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014294
Domain Number 1 Region: 235-583
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.62e-129
Family Mammalian PLC 0.00000000000943
Further Details:      
 
Domain Number 2 Region: 67-231
Classification Level Classification E-value
Superfamily EF-hand 1.44e-46
Family EF-hand modules in multidomain proteins 0.0000000833
Further Details:      
 
Domain Number 3 Region: 900-1072
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 2.35e-45
Family C-terminal domain of PLC-beta 0.00000319
Further Details:      
 
Domain Number 4 Region: 614-725
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.09e-22
Family PLC-like (P variant) 0.00000211
Further Details:      
 
Domain Number 5 Region: 2-64
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000393
Family Pleckstrin-homology domain (PH domain) 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014294   Gene: ENSEEUG00000015644   Transcript: ENSEEUT00000015658
Sequence length 1106
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4171:6878:27196:-1 gene:ENSEEUG00000015644 transcript:ENSEEUT00000015658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQKLRDVFNMDFPDNTFLLKALTVVSGPDMVDLTFHNFVSYKENVGKDWAEDVLALAKHP
MTANAPRSTFLDKILVKLKMQLNPEGKIPVKNIFQMFPADRKRVEAALSCSHSPKAKNDA
INPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEHLAEFINKKQRDPGLNSL
LFPPARPDQVQGLIHKYEPSGINVQRGQLSPEGMVWFLCGPENSVLTQEKLLLHHDMTQP
LNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDCWKGKLPDEEPIITHGFT
MTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKMAEYCRTLFGDMLLTEPL
EKFPLKPGTPLPSPEDLRGKILIKNKKNQFSGSAAPSKEEGGQPEGNCPPGEGPVVWAGE
EGAELEEEMVEEDEEEESGSLDEEEIKKLQSDEGTAGLEVTAYEEMSSLVNYIQPTKFIS
FEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSRIYPKGTRMDSSNYMPQMF
WNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMRRPDKQFNPFSVDRIDVVV
ATTLSITARAGWAVISGQFLSDRSVRTYVEVELFGLPGDPRRYRTKLSPSTNSINPVWKE
EPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHLCLHSESNMPLTMPAL
FVFLEMKDYVPDTWADLTVALANPIKFFNAHDKKSVKLKEAMGVPQEKPFLLGGTAASLS
GRLPPTSNGSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSAAGEEGSGAAPGDCPDG
ADARRRELRRRLEQELRLQAEEQCQGVRQRKEQHVSEHVAKVLELAREKQAAELKSLRET
LDNDTKEIKKKLETKRLERIQAMVKVTTDKMAQERLKREINNSHIQEVVQAIKQVTGNLQ
RQQEKLEEKQAACLEQIREMEKQFQPEVLAEFEAKMTGLEAEVKESLRVCFPSEAEDKPW
EPIGVLGGSCEQELLTAKTEAQESRL
Download sequence
Identical sequences ENSEEUP00000014294 ENSEEUP00000014294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]