SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014327 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014327
Domain Number 1 Region: 144-291
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-41
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 2 Region: 68-195
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-27
Family SH3-domain 0.0000358
Further Details:      
 
Domain Number 3 Region: 258-347
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-21
Family Protein kinases, catalytic subunit 0.0000142
Further Details:      
 
Domain Number 4 Region: 425-468
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000728
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014327   Gene: ENSEEUG00000015691   Transcript: ENSEEUT00000015692
Sequence length 468
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_153:261:93566:-1 gene:ENSEEUG00000015691 transcript:ENSEEUT00000015692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGDAGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSFKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYP
Download sequence
Identical sequences ENSEEUP00000014327 ENSEEUP00000014327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]