SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014372 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014372
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000381
Family Phosphotyrosine-binding domain (PTB) 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014372   Gene: ENSEEUG00000015735   Transcript: ENSEEUT00000015746
Sequence length 397
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6747:46:67813:1 gene:ENSEEUG00000015735 transcript:ENSEEUT00000015746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETGLIIKGGNRPILFRLPELGDQSRRLAISVNTGLPATDAQGLRAGELLKVKFIREVTPY
IKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKVIPLKMCFAARNLSMPDLE
NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTRDAWASPCHSYPLIATX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXCTLNGQEVRLTVHYENGFSISRENGGSSSMLYRYPFERLKMSADDGIRNLYLDF
GGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences ENSEEUP00000014372 ENSEEUP00000014372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]