SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014382 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014382
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-23
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 2 Region: 518-628
Classification Level Classification E-value
Superfamily DNase I-like 3.27e-18
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0018
Further Details:      
 
Domain Number 3 Region: 302-433
Classification Level Classification E-value
Superfamily DNase I-like 0.00000000000245
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014382   Gene: ENSEEUG00000015743   Transcript: ENSEEUT00000015756
Sequence length 1012
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_6760:10263:111028:1 gene:ENSEEUG00000015743 transcript:ENSEEUT00000015756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNED
DKFTVQASEGVPMRLFTKLDQLIEFYRKENMGLXXXXXXXXXXXXXXXXXXXXXXXXGVI
SPPELPPRNIPLSTVPCEADSPSVSSESPRATEASRPSLSETLLQRLQNMDTSGLPEEHL
RAIQDYVSTQLGLDSDFARTGSSGLPHLRKTVLCRELYGXXXIVPSXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKREGF
CQLLQQMKNKHSEQPEPDMITIFVGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPH
DIYVIGTQEDPLGEKEWLETLRQSLQEITSMTFKTVAIHTLWNIRIVVLAKPEHENRISH
ICTDNVKTGIANTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAEAIIHKIRQQQYSELLCHDQLLMER
KEQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVH
VVCQSYGDTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGAADRQGQVEFLRCYATLKTKS
QTKFYLEFHSSCLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXEGCIALRLEATETPLPIYTPLTHHGEMTGHFRGEIKLQTSQGKMREKL
YDFVKTERDESCGPKSLKSLTSHDPMKQWEPTSRAPAGGGCALTEIINPNYMGVGPFGHM
KQTLSPDLQPTAWSYDPPLKESSLGPGRGESPPTPPSQPPISPKKFLCSVTPRGPSSRTQ
EAPTPRLRSFTCSSSSTARGDKAQAKPRASAAGTPAPVPSKRPVKPSRSELSQPGQPAPS
PLPSTRPPLPVKSPAVLHLQHAKGRDYRDSSELPHHGKLRPEDTPLGRAAMQ
Download sequence
Identical sequences ENSEEUP00000014382 ENSEEUP00000014382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]