SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014405 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014405
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.59e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014405   Gene: ENSEEUG00000015778   Transcript: ENSEEUT00000015780
Sequence length 249
Comment pep:known_by_projection scaffold:HEDGEHOG:scaffold_244659:2263:3012:-1 gene:ENSEEUG00000015778 transcript:ENSEEUT00000015780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLANSEANTRRINIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPVRICDFCYDLLSTGDMATCQPARSDSYSQSLKSPLNDVSD
DDDDDDSSD
Download sequence
Identical sequences A0A1S3AB18
ENSEEUP00000014405 9615.ENSCAFP00000013871 ENSEEUP00000014405 XP_007532261.1.11023 XP_013964790.1.84170 XP_016047623.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]