SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014441 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014441
Domain Number 1 Region: 442-584
Classification Level Classification E-value
Superfamily Bet v1-like 6.11e-25
Family STAR domain 0.018
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-20
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014441   Gene: ENSEEUG00000015810   Transcript: ENSEEUT00000015817
Sequence length 592
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2370:4790:47094:-1 gene:ENSEEUG00000015810 transcript:ENSEEUT00000015817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTNYIHGWQDRWVVLKNNTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVND
SVWYLRAQDPDHRQHWVDAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSAASTSSFK
KGHSLREKLAEMETFRDILCRQVDTLQKFFDACADAVSKDELQRDKVVEDDEDDFPTTRS
DGDFLHNTNGNKEKVFPYITPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDS
WQKRLDKEGEKKRRFEEAYKNAMIELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDR
QDKIEEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVEEMVHNHMTYSLQDVGGDANWQLVVEEGEMKXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXTIENFHVVETLADNAIIVYQTHKRVWPASQRDVLYLSAI
RKILALTENDPETWIVCNFSVDHSSAPQNNRCVRAKINIAMICQTLVSPPEGDQEISRDN
ILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTSGKPILF
Download sequence
Identical sequences ENSEEUP00000014441 ENSEEUP00000014441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]