SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014444 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014444
Domain Number 1 Region: 124-174
Classification Level Classification E-value
Superfamily PH domain-like 2.91e-16
Family Phosphotyrosine-binding domain (PTB) 0.0041
Further Details:      
 
Domain Number 2 Region: 531-606
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000118
Family SH3-domain 0.0000618
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000014444
Domain Number - Region: 726-773
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000335
Family Pointed domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014444   Gene: ENSEEUG00000015815   Transcript: ENSEEUT00000015822
Sequence length 822
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5205:2455:107139:-1 gene:ENSEEUG00000015815 transcript:ENSEEUT00000015822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHVSNHPSGFGIYPSQMNGYGSSPTFSQMDREQGSKTSAKALYEQRKNYARDSVSSVS
DISQYRVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXNELENFPLSTIQHCQPVMHSCNYDSILALVCKEPTQNKPDLHLFQCEEVKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXMISKADPGIPPPPRAPAPVPPGTVTQVDVRSRVAAWSA
WAADQGDFEKPRQYHEQEETPEMVAARIDRDVXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGVLTLRAKPPPPDEFVDCFQKFKHGFNLLAKLKSHIQNPSASDLV
HFLFTPLNMVVQTTGGPELASSVLSPLLTKDTIDFLNYTVSAEERQLWMSLGETWMKARA
EWPKEQFIAPYVPRFRNGWEPPMLNYMGVRVEQDLYQLAESVANVAEHQRKQEAKRLSTE
HSSMSDYSPADGYTFNNAYRAPHLDQADTAVAFKPTPNRHVERNYEPTIPQPKKYAKSKY
EFTARNHSELSVQKDDILEILDDRKQWWKVRNASGDSGFVPNNILDIVRAPESGLGRADP
PYTHTIQKQRMEYGPRPADTPLAPSPPPTPAPVPVPLPPSTPAPVPVSKVPANVTRQNSS
SSESGGSIVRDSQRHKQLPVDRRKSQMEEVQDELIHRLTIGRSAAQKKFHVPRQNVPVVN
ITYDSTPDDVKAWLQSKGFNPVTVNSLGVLNGAQLFSLNKDELRTVCPEGARVFSQITVQ
KAALEDNSGSSELQEIMRRRQEKISAAASDSGVESFDEGSSH
Download sequence
Identical sequences ENSEEUP00000014444 ENSEEUP00000014444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]