SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014558 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014558
Domain Number 1 Region: 231-333,362-440
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.14e-45
Family Protein kinases, catalytic subunit 0.0000000575
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-40
Family SH2 domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 51-172
Classification Level Classification E-value
Superfamily SH3-domain 6.04e-23
Family SH3-domain 0.0000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014558   Gene: ENSEEUG00000015940   Transcript: ENSEEUT00000015943
Sequence length 441
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7729:5887:15698:1 gene:ENSEEUG00000015940 transcript:ENSEEUT00000015943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKGLLPMRNGSEVRDPLVTYEGSDPPASP
LQDNLVIALHSYKPSHDGDLGFEEGEQLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESETTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFSGLHELVRHYTNNSDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENDSFLDFQLEKGLGAAPWGKLGQLLLLLTGSLVDFLKTST
GMKLTVSKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDN
EYTAREGAQYAIKWTAPEAIN
Download sequence
Identical sequences ENSEEUP00000014558 ENSEEUP00000014558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]