SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000014562 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000014562
Domain Number 1 Region: 377-473
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-25
Family p120GAP domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 162-211
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000143
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 3 Region: 213-279
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000223
Family Synaptotagmin-like (S variant) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000014562   Gene: ENSEEUG00000015938   Transcript: ENSEEUT00000015948
Sequence length 1146
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4059:5260:128955:1 gene:ENSEEUG00000015938 transcript:ENSEEUT00000015948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGGSARKSTGRPSYYYRLLRRPRLQRQRSRSRSRTRPARESPQERPGSRRSLPGSLSE
KSPSMEPSAATPFRVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XSHLMPRLKESRSHESLLSPSSAVEALDLSMEEEVVIKPVHSSILGQDYCFEVTTSSGSK
CFSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDV
LYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKERNSYLGVSLAAVARQF
VEKYPVVTNPGKGLMIRIKRYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKY
LQDALGEFIKALYESDENCEVDPSKCSAADLPEHQGNLKMCCELAFCKIINSYXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSIISKLGPLPRILRDVHTALNAPGSGQLAGTNDLASTPGS
GSSSISAGLQKMVIENDLPGLIDFTRLPSPTPENKDLFFVTRSSGVQPSPARSSSYSEAN
EPDLQMANGGKSLSMVDLQDARTLDGEVGSPAGPDTLTTEGQAPATQLVAGWPTRAVPGS
LAGLATVRRAGQTPTTPSTSEGAPGRPQLLAPLSFQNPVYQMAAGLPRSPRGLGDGSEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSS
KGDSPELKPRAVHKQGPSPVSPNALDRTAAWLLTMNAQLLEDEGLGPDPPHRDRLRSKEE
LSQAEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQED
KDIQMKGIISRLMSVEEELKKDHAEMQAAVDSKQKIIDAQEKRIASLDAANARLMSALTQ
LKESMH
Download sequence
Identical sequences ENSEEUP00000014562 ENSEEUP00000014562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]