SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000000649 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000000649
Domain Number 1 Region: 2196-2290
Classification Level Classification E-value
Superfamily C-type lectin-like 2.83e-30
Family Link domain 0.00014
Further Details:      
 
Domain Number 2 Region: 977-1127
Classification Level Classification E-value
Superfamily FAS1 domain 1.31e-26
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1135-1263
Classification Level Classification E-value
Superfamily FAS1 domain 9.42e-22
Family FAS1 domain 0.0039
Further Details:      
 
Domain Number 4 Region: 1649-1724
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000000209
Family FAS1 domain 0.0025
Further Details:      
 
Domain Number 5 Region: 523-593
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000523
Family FAS1 domain 0.0038
Further Details:      
 
Domain Number 6 Region: 422-504
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000576
Family FAS1 domain 0.0054
Further Details:      
 
Domain Number 7 Region: 1557-1597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000356
Family EGF-type module 0.04
Further Details:      
 
Domain Number 8 Region: 233-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family EGF-type module 0.033
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000000649
Domain Number - Region: 2084-2121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000178
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 2129-2163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 
Domain Number - Region: 875-992
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00157
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 1435-1468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-like domain of nidogen-1 0.055
Further Details:      
 
Domain Number - Region: 2286-2329
Classification Level Classification E-value
Superfamily FAS1 domain 0.00326
Family FAS1 domain 0.034
Further Details:      
 
Domain Number - Region: 197-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00618
Family Merozoite surface protein 1 (MSP-1) 0.04
Further Details:      
 
Domain Number - Region: 829-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0691
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000000649   Gene: ENSEEUG00000000733   Transcript: ENSEEUT00000000733
Sequence length 2495
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3980:3177:258694:1 gene:ENSEEUG00000000733 transcript:ENSEEUT00000000733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPQDVIPLLGLFLQSAFSQHGLMKQTNRCDQKSLLTMRTECKSCPLNFDIECPNGFTKV
TNGSRGVRDCRYTYELRRYSLSLPGCRHICRKVYLQHQCCPGHWGPDCMECPGGAENPCS
GRGRCAEGLEGDGSCTCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXIPECAALLCPKNARCSTSTEDETKLECKCLPNYRGDGKYCEPINPC
LQPVCHPHAHCTYLGPNQHSCVCQEGYHGDGQVCLPVDPCQVNLGGCPAQSTVCKYDGPG
QSHCDCKDHYHSFVPGVGCHMTDICQSHNPCHRNANCTTIAPGQTXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVK
ELLADTQAAQYFVKFHIIAGQMSTELMNTTDTFYTLTGRSGEIFSGDKDNQLKLKLCGGK
KKVKILQGDMVASNGLLHILDRALDKMEPMFESNTEQTIMTMLQPRYSKFRSLLEETSVA
HALEEEGKGEAYTIFVPSNEALSNMHDGTLDYLLSPEGSRKLLELIRYHIVPFTKXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALFTHKCVYISKTRSLKIGCARYCNA
TVKIPKCCKGFYGPDCNQCPGGFSNPCSGNGQXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXCLCIHGTCDNSVTSDGACLDGSCRGGSAGRFCHKQTVACGPYVQFCHIHA
TCKYSNGTASCVCKAGYEGDGGLCTQTDPCVALAPGGCGPNAQCLQTGAGTHSCVCQQGW
TGDGRDCSAINNCLLPGAGGCHDNATCLYVGPGQNECECKKGFRGNGIDCEPITTCLEQT
GKCHPLATCQFTSGIWSCVCEEGYEGDGLLCYGNAAVELSFLSKAAIFNHWINKASLQAM
LAATSNLTVLVPSRQAVENMDQDEKDFWLSTSNIAALIKHHMLQSMYRVSDLQALTPADM
LATSLQGNFLHLEKAGENVTIDGASIIDGDNAATNGVIHIINKVLVPQRGLTGALPNLLT
RLEQMPDYSIFRGYVIQYNLASTIEAADAYTVFAPSNKAIENYIQDKKLASLQEDVLRYH
VIMEEKLLRNDLHNGMHRETMLGFSFQLGFFLHHDQLYVNEAPINYTNVATDKGVIHGLG
QVLEIQKNRCDNNDTTIIRGKCETCHQQPVCPYGNETLSREMKKCIYTIYFHGRRTPFFG
CQAKCVKTVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXCSCVHGRCNQGPSGDGSCECDVGWRGVNCDVAITSDSCNGTCHT
SANCLINQDGTASCRCAAGFQGNGTVCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATCNCLPKYTGDGKVCMLINICLTK
NGGCSEFAVCKHTGLDERTCTCKLGYVGDGITCRGSIFQELPKNPRTSQYFFQLVXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVHDWDKKGIMPQILRYHVIACHQLLLENLKVTPNVTT
LQGESLNISVSQDTVTLNSKAQIISSDIINSNGIIHIIDKLLAPQNLLITPKDANGRILX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDLFLNDQACRI
VQRELLFDLGVAYGIDCLLTDPTLGGRCDSFDTLEVSGVCGSCINTPSCPSWSKAKGTKQ
KCLYNLSFRKSLEGCRQLCALVVSIPKCCKGYFGRDCQACPGGPEAPCNNQGVCLDHYSS
TGQCRCNVGFNGTACELCLPGRFGPNCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLPLVCTPPCSAHATCKENNTCECNLNYEGDGIACTVVDFCKQDNGGCARVAKCSQK
NTTVSCSCPKGYTGDGYSCTEIDRCADGFNGGCHEHATCKMTGPGKIKCECKSHYVGDGL
DCEPEQLPVDRCLQDNGQCHADADCADLHFQDTTVGVFHLRSPLGQYKLTFNKAQEACAK
EAAAMATYNQLAYAQKAKYHLCSAGWLATGRVAYPTAYSSKSCGSGVVGIIDYGPRNNRS
ELWDVFCYRMKDVNCTCKVGYVGDGFSCSGNLLQVLTASPSLTHFVTXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASVHTGMGT
GIFFAVFLVIGSLASAVYTYFRLKRRTTIGFQHFE
Download sequence
Identical sequences ENSEEUP00000000649 ENSEEUP00000000649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]