SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001152 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001152
Domain Number 1 Region: 86-429
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.18e-53
Family L-arabinose binding protein-like 0.00052
Further Details:      
 
Domain Number 2 Region: 508-698
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.13e-39
Family Protein kinases, catalytic subunit 0.00065
Further Details:      
 
Domain Number 3 Region: 868-926
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.0000000000251
Family Adenylyl and guanylyl cyclase catalytic domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001152   Gene: ENSEEUG00000001281   Transcript: ENSEEUT00000001286
Sequence length 1074
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_659:3868:188527:-1 gene:ENSEEUG00000001281 transcript:ENSEEUT00000001286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTSLLDLVLWLLLLHLRLMSWASQLRRNCNDGSYEITVLMMNNSAFQVPLDNLTTAVNK
GVDIVRQRLLEAGLNVTVSANFVMPKASIYKTSDCRSSTCEGLDLLRQISSEGWMGCVLM
GPSCTYSTFQMYLDTDLNYPMISAGSFGLSCDYKETLTRLMSPARKLMYFLVDFWKANNL
PFKPFSWKTAYVFKNTNESEDCFWYLNALEAGVSYFSQELAFKDMLRKEEDFQSILIDQN
RKSNVIVMCGTHQTICSLKGDREVAEDTVIILVDLFNNYYFQDNITALDCMKNVLVLTLP
PENTSHSSSDRFISGNLSRANNDFARAYLDGVLLFGHILQKFLESGEDVTSPKFAHAFRQ
LTFQGYTRPVTLDNCGDIDNRMVLLYTSVETKKYKILMNYYKNKTEAVDKSPMFIWKNHK
LPSDIPGQGPEVLMIAVFTLTGAVVVIMFIALIVLRKYKKNNELRQKKWSHIPPENIYPX
XXXXXXXXXXXIDDDKRRDTIQRLQQCKYDKKRVILKDLKHNDGNFTEKQKIELNKLLQI
DYYNLTKFYGTVKLDSTIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKTSVLCDIAK
GMSYLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNSILPPKKDLWTAPEHLRQAGISQ
KGDVYSYGIIAQEIILRRETFYTLSCRDEQEKIFRVEHSNGVRPFRPDLFLETAEEKELE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVETIGDAYMVASGLPKRNGNRHAIDIAKMALD
ILSFMGTFELEHLPGLPVWIRIGVHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXENQ
QRLQAEFSDMLANSLQKRQAAGIRNRKPARVPSYKKGTLEYLQLNTTDKESTQF
Download sequence
Identical sequences ENSEEUP00000001152 ENSEEUP00000001152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]