SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000001909 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000001909
Domain Number 1 Region: 1513-1763
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-39
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 760-907,941-988
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.73e-29
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 132-272,362-431
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.73e-28
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 1194-1280,1313-1349,1385-1464
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.37e-22
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000001909
Domain Number - Region: 1770-1810
Classification Level Classification E-value
Superfamily EF-hand 0.017
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000001909   Gene: ENSEEUG00000002086   Transcript: ENSEEUT00000002095
Sequence length 1988
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5345:10598:107653:-1 gene:ENSEEUG00000002086 transcript:ENSEEUT00000002095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKSQKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMSELEDLDPYISKKTFIVLNKGKAIFRFSAASALYILTPLNPVRKIAIK
ILVHSYPFCKIMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYLNGTMD
SNGTLINVTMSTFNWKDYIDDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATXXXXXXXXXXXXXXXXXXXXXXXXXXAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNHRRKKRRQREHFEVDNKEEGDRLPKSESEDSVKRRSLPF
SMDGNRLSDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGTTTETEIRKRRLSSYQISMEMLEDSSGRQRAMSIASILTNTMEELE
ESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAME
HYPMTGQFSSVLXXXXXVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELG
LANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKISSDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKN
MIRECFRTTFLRKPKVLEIHEGNKIDSCISNNTGVEISKELNYLKDGNGTTSGVGTGSSV
EKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATSSSE
GSTVDVAPPREGEQAETEPEGCIKKFPFCQVSIEEGKGKIWWNLRKTCYSIVEHNWFETF
IVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGFQTYFTNA
WCWLDFLIVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVVNALVGA
IPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNTTTGNMFEVNEVNNFSDCQALGKRA
RWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPVYEENLYMYLYFVIF
IIFGSFFTLNLFIGVIIDNFNQQKKKISQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPS
NKFQGMVFDFVTRQVFDIGIMILICLNMVTMMVETDDQSKYMTLVLSRINLVFIILFTGE
FVLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAKLIEKYFVSPTLFRVIRLARIGRIL
RLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEAGIDDMFNF
ETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDKIHPGSSVKGDCGNPSVGIFFFV
SYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFIEFAK
LSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRI
QMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLRQRLKKVSSEYNKEAI
KGRIDLPIKEDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEKFEKDKPEKESKG
KEGRENQK
Download sequence
Identical sequences ENSEEUP00000001909 ENSEEUP00000001909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]