SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002337 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002337
Domain Number 1 Region: 275-403
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.05e-26
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 740-814
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.000000153
Family Diacylglycerol kinase-like 0.085
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily PH domain-like 0.00000237
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000002337
Domain Number - Region: 107-144
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00628
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002337   Gene: ENSEEUG00000002535   Transcript: ENSEEUT00000002557
Sequence length 1047
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8676:4788:162419:-1 gene:ENSEEUG00000002535 transcript:ENSEEUT00000002557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KILKEGPLLKNCNSFQRWKLRYFQVRGQRLCFAHHPAFARFDTIDLSQAALAESSCRNLC
HSFCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPDAENNPFLIGMHYWYSGHS
PRTQHCNVCRESIPALSRNVIVCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHNDCRRRFSKECWFGSHR
SSVIPPTALSDPKGNGQLVVSSDFWSLDWSSACSCPLLIFINSKSGDHQGIVFLRKFKQY
LNPSQVFDLSKGGPEAGLCMFKNFARFRIVVCGGDGSVSWVFSLIDAFGLHERCQLAVIP
LGTGNDLARVLGWGAFWNRNKSPLNILNRVEQARVRILDRWSVMIRETPRQTPLSEGVVM
DFPRFAAAIQHIESATIELNKILKAKYPTEMIIATRFLCLAVDDFVADIVKAWSQIKQNN
TTIESVILKSDIMYDKLSVLIDVLAEETAAEKSAAVHTDSSKVDGKPFFIPPIDHTTKCK
LELTVKAQNLQKSLKLIIFQVEQVLDEQSRQTLSVRNFSSTFFLDDDSEDVSQMSPRHGS
RRDTVSSLCSLQSEDLDHLNLDYLHSKPETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXEYEAPAIDDGKLEVVAIFGSVQMAMSRVINLHHHRIAQCREVMIT
IHGEEGIPVQVDGEAWVQRPGIKIRYKNAAQVLTRDRXXXXXXKMWECKHTEIQAASQPQ
LDSQDSQDSLSDKEYAQLQHVAQLAENLISRLTDLSKVHQHVSVLMDSVTTTADILNDVF
YSQESEAGAAFCTPIEASKNDAVEVTMELKWFNDETKAIRDQTLLRNTEDEAMLQTSLDA
MNMGFEKLFEFEWMNSIFVPEGKSEDTDSRRVRLKTKFPRLGKKRLAEEGKHRSGQELQS
FIGNLWHRRNREDEEKDDDPPESSFQL
Download sequence
Identical sequences ENSEEUP00000002337 ENSEEUP00000002337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]