SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000002470 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000002470
Domain Number 1 Region: 324-520
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-31
Family BCR-homology GTPase activation domain (BH-domain) 0.00078
Further Details:      
 
Domain Number 2 Region: 162-241
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000253
Family Ras-binding domain, RBD 0.017
Further Details:      
 
Domain Number 3 Region: 87-152
Classification Level Classification E-value
Superfamily PH domain-like 0.00000191
Family Pleckstrin-homology domain (PH domain) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000002470   Gene: ENSEEUG00000002672   Transcript: ENSEEUT00000002696
Sequence length 893
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4154:19919:49165:-1 gene:ENSEEUG00000002672 transcript:ENSEEUT00000002696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMKSVSERRKSAPSLFLERAIMQKRPSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCNNNFKLKNKIKLTDMWTANCIDEVGEGHTSAIKSF
VLGWPVVNFVVTFSSSEEKEKWMCLLQRYITLEKEKEFPKTVPLKVYAKEMSSCADSKTI
MAANTDTVNEVVKMLLPEFGMTGTVSDFQLWLNSGKEGAPYPLIGHEYPYVIKMHHLRDT
ALLAEGPKDAMMPDNFQEPFVMEQLPQEMQCHFILKSRHLSLTQKLSDSGSKTFKRRKSI
MSWAFWRGSQAHLDNMPLSPTSPVPGQLFGASLGDICTGEDLPRPIMDLIIYLYKKGPLT
VGIFRLSASARAIREFKEKLQLNFSSGVEVNLDMESPILVAAVLKNSRNIPGSLLSSEFY
HCWICIVDEENREDRISTIKXXXXXXXXXXXXXXXXXXXXXXXXXQNSSVNQMNTFNLAV
CFTPTLLWPPTNTDRELESSFTKKVTLLVQFVIENCCELFGEGITSLLREDSLQCNTTEN
TTVYPKKRKSSCDAVLLQKDGEFQGESKIVSDVSLLTETNTYSKKGLREPVSKYRPMSIA
VDSDTSSQNGSTNRLPNTNTSSTPASPTSQRCRSESNMGKNHHTLNCLRGIFTKQKTSYP
LDLLDGQDKSKHPEWDSGSPTKQIRSTTDSTVSSPGTSSPGDSKSQESDIFGNYHAGFTA
LETTQNNSEELSSHLDSAMPGPSSAQASPKKGWHSQVHSVTWLRNSLANLKNWSFRRTRT
SKAEEKQPGSPRESPPPASSGKVMPFKEAGVENIQKDQVESPQPCRDLMEHCRCTCNLLI
CVNLYIKLDEGGGLSEHCAAGPLSHTNDLDLSNPDSGSSENCDVRGGHTNEEC
Download sequence
Identical sequences ENSEEUP00000002470 ENSEEUP00000002470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]