SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003324 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003324
Domain Number 1 Region: 49-131
Classification Level Classification E-value
Superfamily HMG-box 2.23e-28
Family HMG-box 0.0000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003324   Gene: ENSEEUG00000003666   Transcript: ENSEEUT00000003648
Sequence length 477
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3186:66995:69487:1 gene:ENSEEUG00000003666 transcript:ENSEEUT00000003648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIK
RPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHM
ADYPDYKYRPRKKVKSGNASSSSSGAATSKPGEKGDKVGGSGGGGHGGGGGSSSSSSHAG
GGGGSASGGGGSNSKPAQKKSCGSKVAGGAGGGVSKPHAKLLLASGGGNKAAAAAATFAA
EHAVAAALLPLGLAADHNALYRVLSPSSSSASSAAAASANLAAPGKHPAEKKVKRVYLFG
GLGSASSPPVGGVGAGADPSDPLGLYEEGGAGCSPDGPSLSGRSSAASSPAAGRSPADHR
SYAGLRAASPAPSSAPSHASSSASSHSSSSSASSSGSSSSDDEFEDDLLDLHPSSNFESM
SLGSFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY
Download sequence
Identical sequences ENSEEUP00000003324 ENSEEUP00000003324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]