SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003422 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003422
Domain Number 1 Region: 272-599
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-68
Family Protein kinases, catalytic subunit 0.000000158
Further Details:      
 
Domain Number 2 Region: 40-75
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00047
Further Details:      
 
Domain Number 3 Region: 177-228
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000436
Family Synaptotagmin-like (S variant) 0.00013
Further Details:      
 
Domain Number 4 Region: 2-30
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003422   Gene: ENSEEUG00000003724   Transcript: ENSEEUT00000003755
Sequence length 606
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5420:1130:205742:1 gene:ENSEEUG00000003724 transcript:ENSEEUT00000003755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHC
GSLLYGLIHQGMKCDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLKPSDKDR
RLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVILRDEGIALQ
KKAKLGPAGNKVITPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELY
AIKILKDVVIQDDDVECTRVEKRVLTLLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLM
YHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCK
EHMMDGVTTRTFCGTPDYIAPEXXXXXXXXXXXXXXXXXXXXXXXXXXXPPFDGEDEDEL
FQSIMEHNVSYSKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRIDWEKLE
NREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFMHP
VSQSSV
Download sequence
Identical sequences ENSEEUP00000003422 ENSEEUP00000003422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]