SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003474 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003474
Domain Number 1 Region: 597-881
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-74
Family Protein kinases, catalytic subunit 0.00000000585
Further Details:      
 
Domain Number 2 Region: 2-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-69
Family Ephrin receptor ligand binding domain 0.00000203
Further Details:      
 
Domain Number 3 Region: 406-504
Classification Level Classification E-value
Superfamily Fibronectin type III 5.34e-23
Family Fibronectin type III 0.00000298
Further Details:      
 
Domain Number 4 Region: 900-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.24e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000003474
Domain Number - Region: 226-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0408
Family Growth factor receptor domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003474   Gene: ENSEEUG00000003796   Transcript: ENSEEUT00000003810
Sequence length 971
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_684:4579:32062:1 gene:ENSEEUG00000003796 transcript:ENSEEUT00000003810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMIPNQNNWLRTNWVPRD
GARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQENQFLKIDTIAADE
SFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPTMVRNLA
AFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERQDA
CVACELGFYKSAPGDQLCAHCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSQVVVIRQEHAG
QTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQV
RARTSAGCGRFSQAMEVETGKSRPHYDTRTIVWICLTLITGLVVLLVLLICKKRHCGYSK
AFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKIPEPQFYAEPHNYEEPGRAGCSVTREIEA
SRIHIEKIIGSGESGEVCYGRLRVPGQRDVPVAIKALKAGYTERQRQDFLSEASIMGQFD
HPNVIRLEGVVTRGPXXXXXXXXXXXGSLDAFLRTHDGQFTIMQLVGMLRGVGAGMRYLS
DLGYIHRDLAARNVLVDGNMVCKVSDFGLSRVLEDDPDAAYTTTGGKIPIRWTAPEAIAF
RTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPRALHQLML
DCWHKDRAQRPRFSQIVSVLDALIRSPESLRATATVSRCPPPAFARSCFDLRGGGGGGLT
VGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQ
LTSTQGPRRHL
Download sequence
Identical sequences ENSEEUP00000003474 ENSEEUP00000003474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]