SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003890 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003890
Domain Number 1 Region: 88-160
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000206
Family Calmodulin-like 0.0000506
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003890   Gene: ENSEEUG00000004295   Transcript: ENSEEUT00000004279
Sequence length 162
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7905:19735:22657:-1 gene:ENSEEUG00000004295 transcript:ENSEEUT00000004279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AHRRFCELLPQESRGGQESLRVRVSLEQILSLPELKANPFKERICVFSTALTGXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXFDDDGTLNREDLSCLVNCLTGEGEDTQLSASEM
KQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL
Download sequence
Identical sequences ENSEEUP00000003890 ENSEEUP00000003890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]