SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000003992 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000003992
Domain Number 1 Region: 117-169,339-417
Classification Level Classification E-value
Superfamily EF-hand 0.000000000336
Family Calmodulin-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000003992   Gene: ENSEEUG00000004380   Transcript: ENSEEUT00000004388
Sequence length 453
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5188:16351:36537:-1 gene:ENSEEUG00000004380 transcript:ENSEEUT00000004388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWKEVLRQRLATSDTGLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLWFLLDKHQTPPMIGEEAMINY
ESFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRVSIMQFFNYVMRKXXXXXXXXXXXXX
XXXXXXXXXXXDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPFKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDSENAADLDDT
Download sequence
Identical sequences ENSEEUP00000003992 ENSEEUP00000003992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]