SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004022 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004022
Domain Number 1 Region: 298-411
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-33
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 3 Region: 452-557
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.83e-24
Family Frizzled cysteine-rich domain 0.00023
Further Details:      
 
Domain Number 4 Region: 258-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000004022
Domain Number - Region: 417-441
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0432
Family LDL receptor-like module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004022   Gene: ENSEEUG00000004410   Transcript: ENSEEUT00000004422
Sequence length 564
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7888:36:7183:-1 gene:ENSEEUG00000004410 transcript:ENSEEUT00000004422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSDIILCVEATPLSKTEFCNPAFEPESGPPSSHQAFQEDADCATQAPWHGQRPRGLQ
PDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQATPPSVAPDHPLPAPRPTTATTSTTTT
TTQTTATPGEQQETDRSPTLSTCGGLLPGPRGFFSSPNYPDPYPSNAHCVWHIRVATDQV
IQLRIEALSMESAASCLFDRLEISPEPEPLLRVCGRVPPPTLNTNASQLRVAFVSDSSVE
SFGFHAWYQAVAPGHGDCAHDEFHCDQLVCLLPDSVCDGFANCADGSDETNCGTTLLGCG
GNLTGLQGTFSAPSYLQQYPHQQLCTWHISVPTGYGIELEFHNFSLEALEECKLDYVEVY
EASNSGAISLLGRFCGADPPHRLVSRHHQLAVLFRTNHGINSRGFSATYQALNTTEGDSG
CKNLQWICDTWRNCVGSGDNCSSPLVPPRELACEPIRVEMCQGLSYNTTAFPNIWVGMAT
QDEVVEVLRGYKSLTRLPCYQPFRRLLCGLLVPHCTRLGSVLPPCRSVCLEAEHQCQPGL
ALGTPWPFNCNRLPEAGLEACAQP
Download sequence
Identical sequences ENSEEUP00000004022 ENSEEUP00000004022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]