SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004274 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004274
Domain Number 1 Region: 20-490
Classification Level Classification E-value
Superfamily Sema domain 2.35e-172
Family Sema domain 0.000000000000134
Further Details:      
 
Domain Number 2 Region: 493-539
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000798
Family Plexin repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 553-622
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000133
Family I set domains 0.000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004274   Gene: ENSEEUG00000004678   Transcript: ENSEEUT00000004694
Sequence length 851
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3111:70379:98444:-1 gene:ENSEEUG00000004678 transcript:ENSEEUT00000004694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMLLPALAMLLGTAAAFAPTPRITWEHREVQLVQFHEPGVFNYSILLLSEDRDTLYVGAR
EAVFAVNALNISEKQHEVHWKVSEDKKAKCAEKGKSKQTECLNYVRVLQPFSAGVLYVCG
TNAFQPTCDHLNLTSFKFLGRNEDGKGRCPFDPAQSYTSVMVDGDLYSGTSYNFLGSEPI
ISRISSHSPLRTEYAIPWLNEPSFVFADVIRDSLDSGDDRVYFFFTEVSVEYEFVFKLMI
PRVARVCKGDLGGLRTLQKKWTSFLKARLICARPDSSLVFNVLQDVFILQARGLKEPVFY
GVFTPQLNNIGLSAVCSYNLSTVEGVFSRGKYMQSATVEQSHTKWVRYNGAVPTPRPGAC
INRAARAANFSSSLNLPDKTLQFVKDHPLMDDSVTPIDSKPRLIKSGVNYTQIVVDRTQA
LDGAFYDVMFVSTDRGALHKAVSLNGDVHIIEETQLFQDLEPVQTLLLSSKKGRKFVYAG
SNSGVVQAPVAYCRNHITCQDCVLTRDPYCAWSPTEAACVALHETDGPRRALIQDMSGDV
STCPDKVRESFRQHFFKHGGTAELKCSQRSNLARVVWKFQNGVLTAESPKYSLVRRNNLL
IFNLSEGDSGVYQCLAEEKVRNKTVLRLVAKHILEVRVLSPQTPVVTIPPATRTEASRLT
PKESVGPTSSRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXPNPALDTGYETEQDPMASRVPTDREDSQRLDDPPVRNKPFDVKCE
LKFADSDADGD
Download sequence
Identical sequences ENSEEUP00000004274 ENSEEUP00000004274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]