SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000004858 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000004858
Domain Number 1 Region: 194-467
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.01e-81
Family Mitochondrial carrier 0.0000267
Further Details:      
 
Domain Number 2 Region: 10-169
Classification Level Classification E-value
Superfamily EF-hand 1.49e-38
Family Calmodulin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000004858   Gene: ENSEEUG00000005321   Transcript: ENSEEUT00000005337
Sequence length 477
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1031:16726:127978:-1 gene:ENSEEUG00000005321 transcript:ENSEEUT00000005337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRWLRGFVLPVAACQDAEAQKRYETLFQKLDRNRDGVVDIRELQEGLRNLGVPLGQEAE
EKIFSSGDTNKDGKLDLEEFIRYLKDHEKKMKLAFKTLDKNKDGKIDASEIVKSFKMLGL
SISLKQAEFILESIDDDGTMTVDWEEWRDYFLLNPVTDIEEIVHFWKHSTGIDIGDSLTI
PDEFTEEEKKTGLWWKQLLSGGVAGAISRTCTAPLDRLKVMMQVHGSKSGKMKISDGFRQ
MVKEGGFLSLWRGNGTNVIKIAPETAIKFWAYEQYKKLLTDEGKKIGTFERFISGSLAGA
TAQTFIYPLEVMKTRLAVGKTGQYSGLFDCAKKILKHEGVGAFYKGYIPNLLGIIPYAGI
DLAVYELLKSHWLDNFAEDTVNPGVTVLLGCGALSSACGQMASYPLALVNTRMQTQAMIE
GAPQMSMVGLFRRILSKEGLIGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVSQK
Download sequence
Identical sequences ENSEEUP00000004858 ENSEEUP00000004858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]