SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005114 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005114
Domain Number 1 Region: 118-543
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.63e-133
Family Calponin-homology domain, CH-domain 0.0000000143
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily EF-hand 1.52e-17
Family Calmodulin-like 0.03
Further Details:      
 
Domain Number 3 Region: 584-624
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000209
Family Calponin-homology domain, CH-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005114   Gene: ENSEEUG00000005600   Transcript: ENSEEUT00000005615
Sequence length 627
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4002:5410:38560:-1 gene:ENSEEUG00000005600 transcript:ENSEEUT00000005615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSVSDEEMMELREAFAKVDTDGSGYISCNELNDLFKAACLPLPGYRVREITENLMAT
GDLDKDGKLSFDEFIKVIHGLKSSDVAKTFRKAINKKEGICAIGGTSEQSSIGTQHSYSE
EEKYAFVNWINKALENDPDCQHVVPMNPNTDDLFNAVGDGIVLCKMVNLSVPDTIDERTI
NKKKLTPFTIQENLNLALNSASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADI
ELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENSGCNKITNFSTDIKDSRAYY
HLLEQVAPKGDEEGIPAVLIDMSGLREKDDIQRAECMLQQAEKLGCRQFVTATDVVRGNP
KLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDL
SDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNXXXLENCNYAVELGKNQAKFSLVGIGG
QDLNEGNRTLTLALVWQLMRRYTLNILEDIGGGQKVNDDIIVNWVNETLKEAGKSSSISS
FKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYAISMARKIGARVYAL
PEDLVEVNPKMVMTVFACLMGKGMKRV
Download sequence
Identical sequences ENSEEUP00000005114 ENSEEUP00000005114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]