SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005276 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005276
Domain Number 1 Region: 144-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-98
Family Protein kinases, catalytic subunit 0.0000000000838
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000132
Family Pleckstrin-homology domain (PH domain) 0.00000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005276   Gene: ENSEEUG00000005774   Transcript: ENSEEUT00000005788
Sequence length 479
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_436:313356:582748:-1 gene:ENSEEUG00000005774 transcript:ENSEEUT00000005788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCVDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences ENSEEUP00000005276 ENSEEUP00000005276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]