SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005538 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005538
Domain Number 1 Region: 563-1039
Classification Level Classification E-value
Superfamily Ras GEF 1.1e-140
Family Ras GEF 0.0000000000000162
Further Details:      
 
Domain Number 2 Region: 5-174
Classification Level Classification E-value
Superfamily Histone-fold 1.19e-55
Family TBP-associated factors, TAFs 0.0000000833
Further Details:      
 
Domain Number 3 Region: 195-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-42
Family DBL homology domain (DH-domain) 0.00000000296
Further Details:      
 
Domain Number 4 Region: 415-570
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-39
Family Pleckstrin-homology domain (PH domain) 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005538   Gene: ENSEEUG00000006036   Transcript: ENSEEUT00000006069
Sequence length 1319
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_2590:50181:183781:-1 gene:ENSEEUG00000006036 transcript:ENSEEUT00000006069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPPYDFFCEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLCQAQ
PRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKID
HQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDI
NILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSTNDVE
NIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYARDIL
RPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEK
SEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMN
EIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGA
SNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDESVIFSAKSAEEKNNWMAALISL
QYRSTLERMLDVTVLQEEKEEQMRLPSAEVYRFAEPDSEENILFEENMQPKAGIPIIKAG
TVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADRIAIE
NGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGTVRGK
AMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHTETFDLLTLHPIEI
ARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETEN
LEERVAVVNRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEEA
HELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKV
AEITGEIQQYQNQPYCLRVESDIKKFFENLNPMGASMEKEFTDYLFNKSLEIEPRNSKPP
PRFPKKYSYPLKSPGVPPSNPRPGPMRHPTPLQQEPRKISYSRIPESEPESTASAPNSPR
TPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFVQLTQPHGPRSASVSSISFKSTE
AAPVPPPVPPRRRPESAPAESSPSKVLPKPLDNPPAIPPRQPTAKAYSPRYSLSEPPDSP
GPPLLPPREPVRTPDVFSSSPLRLQPPPPGRKGEPGAAFFPSSPAPFTPPPPQTPSPHGP
RRQLPSPPARDPDPQPLAGPPVPPRQSAAQLIPKLPPKTYKREHPAVHRDAPPLLQNAH
Download sequence
Identical sequences ENSEEUP00000005538 ENSEEUP00000005538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]