SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005827 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005827
Domain Number 1 Region: 592-893
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-84
Family Protein kinases, catalytic subunit 0.0000000000911
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-76
Family Ephrin receptor ligand binding domain 0.0000000127
Further Details:      
 
Domain Number 3 Region: 303-508
Classification Level Classification E-value
Superfamily Fibronectin type III 7.11e-41
Family Fibronectin type III 0.0000203
Further Details:      
 
Domain Number 4 Region: 889-963
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.71e-21
Family SAM (sterile alpha motif) domain 0.0000281
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005827   Gene: ENSEEUG00000006359   Transcript: ENSEEUT00000006383
Sequence length 966
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_3696:82522:228166:1 gene:ENSEEUG00000006359 transcript:ENSEEUT00000006383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLMDSTTATAELGWIVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQNNWLRTKFIRRR
GAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADYDSATKTFPNWMENPWVKVDTI
AADESFSQVDLGGRVMKINTEVRSFGPVSRNGFYLAFQDYGGCMSLIAVRVFYRKCPRVI
QNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFE
AVENGTICRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNIICKSCGSGRGACTRCGDNVHY
APRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPFSPQFASVNITTNQAAPSAVSI
MHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSEYNATAIKSPTNTATVQGLKAG
AIYVFQVRARTVAGYGRYSGKMYFQTMTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXRGFERADSEYTDKLQHYTSGHITPGMKIYIDPFTYEDPNEAVREFAKEIDISCV
KIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPN
VIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMN
YVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYR
KFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLD
CWQKDRNHRPKFSQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEW
LEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQI
QSVEGQ
Download sequence
Identical sequences ENSEEUP00000005827 ENSEEUP00000005827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]