SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005898 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005898
Domain Number 1 Region: 732-919,1231-1314,1499-1508
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.16e-80
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000993
Further Details:      
 
Domain Number 2 Region: 177-314
Classification Level Classification E-value
Superfamily EF-hand 1.16e-22
Family Calmodulin-like 0.0031
Further Details:      
 
Domain Number 3 Region: 369-423,518-575
Classification Level Classification E-value
Superfamily DUSP-like 1.57e-21
Family DUSP, domain in ubiquitin-specific proteases 0.0038
Further Details:      
 
Domain Number 4 Region: 80-164
Classification Level Classification E-value
Superfamily EF-hand 0.000000842
Family Calmodulin-like 0.043
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005898
Domain Number - Region: 645-704
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000177
Family Ubiquitin-related 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005898   Gene: ENSEEUG00000006318   Transcript: ENSEEUT00000006459
Sequence length 1510
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6944:24853:130225:-1 gene:ENSEEUG00000006318 transcript:ENSEEUT00000006459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAKESRIGFLCYEEALRRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVIYCSFGGTSKGLHFNLIVGLVLLTRGRDEEKAKYIFSLFASESGSYVVREEMERMLH
VVDGKVPDTLRKCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPTF
YQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAFD
ENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELRDMVVALLEVWK
DNRTDDIPELHTDLSDIVKGILNAHDTTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCH
IVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDTSPVIIE
PSSVLNGGKYSFGTAVHSVEQSEDRIGGGSLSYGNSTEEKFSDNISTASEASETTGSGFL
YSPTPGTDMCFARQHNTSDNNNQCLLGTNGNILLHLSPQKPGAIDNQPLVTQEPVKATSL
TLEGGRLKQTPQLIHGRDYEMVPEPVWRALYHWYGANLAXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNVPSPNAPLKRVLAYTGCFSRMQTVKEIHEYLSQRLR
IKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSS
KIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMK
GHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHED
LNRVHEKPYVELKDSNGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHIS
VRFDPFNFLSLPLPMDSYMHLEITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXNFPQDNQKVRLSVSGFLCAFEIPIPGSPISASSPIQTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFRGCKIDCGEDRAFVGNAYIAVDWDP
TALHLRYQTSQERVVDEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCKT
HCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPALCQ
HKLLSPQGDDFSEPRVPAGEVKKGDTQNSAGEEDILLSKSPSSLSANIISSPKGSPSLSR
KGGASCPSSKSSSPNSSPRTLGRSKGRLRLPQIGSKNKLSSSKENLDASKENGSGQICEL
VGHMLGGSQPDLVTPQDHEVALANGFLYEHEACGNGYNNGHLENHSEEDSTDDQREDIHV
KPIYNLYAIS
Download sequence
Identical sequences ENSEEUP00000005898 ENSEEUP00000005898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]