SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006290 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006290
Domain Number 1 Region: 223-340
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-25
Family Third domain of FERM 0.00054
Further Details:      
 
Domain Number 2 Region: 966-1047
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-22
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 3 Region: 132-225
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-19
Family Second domain of FERM 0.00035
Further Details:      
 
Domain Number 4 Region: 41-107
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-18
Family First domain of FERM 0.0019
Further Details:      
 
Domain Number 5 Region: 736-758,790-842
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000246
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 6 Region: 571-610
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000183
Family DBL homology domain (DH-domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006290   Gene: ENSEEUG00000006835   Transcript: ENSEEUT00000006893
Sequence length 1049
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_5304:10500:51912:1 gene:ENSEEUG00000006835 transcript:ENSEEUT00000006893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQKPTPGSRLGAPENSGISTLEHGQKPPPTPSGKLMSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCSHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRXXXXXXXXXXXXXX
XXXXXXXXXXXXXYLFALQVKQDLAQGRLTCSDTSAALLISHIVQSEIGDFDEASDREHL
AKNKYIPQQDALEDKIVEFHHNHMGQTPAKPNSQLLRTRRRLESYGIRLPPAKTREGPRI
HLAVAXXXXXXXXGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKAVFFSRGSSFRFXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLTASPHL
SELSVNSQGGAVPPSVILSPNLSPDTKQASPLVSPLLNNQANPRTDDEEEGRRKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXWLQSVVSREDTMPETLRSLIFPNFEPLHKFHTNFLK
EIEQRLALXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALAEV
TEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGRXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHRQLPLFG
MTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSES
EEIHKDYVFKLHFKSHVYYFRAESEYTFD
Download sequence
Identical sequences ENSEEUP00000006290 ENSEEUP00000006290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]