SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006979 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006979
Domain Number 1 Region: 919-974
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-17
Family Regulator of G-protein signaling, RGS 0.00026
Further Details:      
 
Domain Number 2 Region: 139-218
Classification Level Classification E-value
Superfamily PDZ domain-like 2.4e-17
Family PDZ domain 0.0000194
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000006979
Domain Number - Region: 430-499
Classification Level Classification E-value
Superfamily PH domain-like 0.000523
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number - Region: 55-108
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0556
Family Synaptotagmin-like (S variant) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006979   Gene: ENSEEUG00000007620   Transcript: ENSEEUT00000007660
Sequence length 974
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_4311:3588:118991:1 gene:ENSEEUG00000007620 transcript:ENSEEUT00000007660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEGKGLMSKDPVICDPYVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVQEEDEQK
RLLVTVWNRXXXXXQSGFIGCMSFGVKSLLTPDKEISGWYYLLGKDLGQTKHLKVARRRL
RPLRDPLLRIPGGGDNVNGETLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQ
QLDTVLQLNERPVEHWKCVELAHEIRSCHGEIILLVWRMVPQVKPGPDGGVLRRASCKSA
HDLLSPPNKREKNCTHGVQARPEQRHSCHLVCDSSNGLLLGGWERYTEVTKRGGQHTLPA
LSRATAPTDPNYIILAPLNPGSQLLRPLYQEDTIPEESGSPTKGKSSYTLGKKSRLMKTV
QTMKGHGNYQNCSIMRPHTPHSNYGTYVTLAPKVLVFPVFVQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVTLFAYSDLLLFTKEDEPGRCNVLRNPLYLQSVKLQEGSSDDLKFCMLYL
AEKAECLFTLEAHSQEQKKRVCWCLSENIAKQQQLAASPPENKMFEPEADEKKEMHLEEG
KGLGAEDPPPSQDPSPDQEPPVDQDTPANKDSSAGQEPPGQEPSGQESLSGKDSPPCNEA
PPGQEATASKDSPPCQGAPLPTALPPCQDLSAKQEPPPRQDFSTIQVPLAQDPPPCQDLL
PSQACLPVDALAQEITSSGTPPGATGDPPATSKPNFVIPEVRLDCAYSQAGAEGGSSGEE
EDVEGVEEGDEGEEDEDEDTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTH
SEGSLLQDTRSPCFSSDTTLHCSDGEGTTAAWAMPSPRTLKKELGRNGGSMHHLSLFFMG
HRKXXXXXXXXXXXXXXXXXXXXXXAKDMKNKLGIFRRWNESPGAQPVGKTDKMKSFXXX
XXXXXXXXXXXXXXXXXXXGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMVAKAK
KIFAEYIAIQACKE
Download sequence
Identical sequences ENSEEUP00000006979 ENSEEUP00000006979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]