SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007077 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007077
Domain Number 1 Region: 327-461,763-937
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.24e-50
Family Diacylglycerol kinase-like 0.015
Further Details:      
 
Domain Number 2 Region: 60-182
Classification Level Classification E-value
Superfamily PH domain-like 1.39e-20
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 3 Region: 1142-1207
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.86e-19
Family SAM (sterile alpha motif) domain 0.0037
Further Details:      
 
Domain Number 4 Region: 226-297
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000406
Further Details:      
 
Domain Number 5 Region: 166-223
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007077   Gene: ENSEEUG00000007702   Transcript: ENSEEUT00000007770
Sequence length 1215
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_1578:2121:326592:1 gene:ENSEEUG00000007702 transcript:ENSEEUT00000007770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASGQQQPPDAAVGSATVPPTTGSAGPVEDSSDSEAEQEGPQKLIRKVSTSGQLRTKT
SIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKXXXXXXXXXXXXXXXXXXXXXXXX
XXXIITPFRRLMLCADNRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYACSHAR
PTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTPPTVGKDIIEDEDGVA
MPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDSYHPVCPLGQCKV
SIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDL
MNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQACQLGVLPLGTGNDLA
RVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKTSLLAEPPEATEEFY
MAIYEDSVTAHLTKILNSDEHAVILSSVKILCDTIKDFLAKVEKAYEKTLENAVVADAVA
SKCSVLNEKLEQLLQVLHMDSQAPSVLPGISPVIIEEEPVESSSEESLCESKEKLTEDTT
RPASQKAVKPKEVILRANSLKKAVRQVIEEVGKVVDDQTVAPCEPVSQSFEYDSAETDES
KEDTKEDDTKESLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
RAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDTVDGYSEKCVMNNYFGIGLDAKIS
LEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSLQG
IAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILVVAIFDSVQMAVSRVIKLQHHRIAQ
CRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDKQKC
DSGKPVIRTHLYIQHAVDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQELAHAVN
ACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEERVSNAL
HSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQKQKTSL
QTVQKWGTEEVAAWLDLLNLGEYKEIFIRHDIRGAELLHLERRDLKDLGIPKVGHMKRIL
QGIKELGRSAPQSEV
Download sequence
Identical sequences ENSEEUP00000007077 ENSEEUP00000007077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]