SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007857 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007857
Domain Number 1 Region: 653-898
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.08e-54
Family Protein kinases, catalytic subunit 0.000000129
Further Details:      
 
Domain Number 2 Region: 413-554
Classification Level Classification E-value
Superfamily Fibronectin type III 6.67e-27
Family Fibronectin type III 0.0000674
Further Details:      
 
Domain Number 3 Region: 920-993
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.08e-16
Family SAM (sterile alpha motif) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 170-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000166
Family Ephrin receptor ligand binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007857
Domain Number - Region: 268-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000606
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007857   Gene: ENSEEUG00000008566   Transcript: ENSEEUT00000008628
Sequence length 1000
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1863:21359:46561:1 gene:ENSEEUG00000008566 transcript:ENSEEUT00000008628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRGLWVLVLASSGLALEEVLLDTTGETSEIGWLTYPPGGXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAWARREAVRVGLQLNVKE
RSFGPLTQRGFYVAFQDTGACLALVAVKLFSYACPSVLRAFASFPETQASGAGGASLVAA
AGTCVAHAEPDEEGGGLQAGGGPPRLHCNGEGRWMVAVGGCRCQPGHQPARGDKICQACP
GGSYKAFAGNAPCLPCPAHSHAPDPAAPVCPCREGFYRASADPPEAPCTXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVVCKECRDLQDRRCRDEVHFDPRQRGLTESRVLV
GGLRAHVPYILEVQAVNGVSELSPDAPQAAAINVSTSHEVPSAVPALHQVSRAADSITVS
WPQPDQTNGNILDYQLRYYDQAEDESRSFTVTSETNTATVTQLSPGHIYGFQVRARTAAG
HGPYGAKVYFQTLPQGEASAQLPERLSLVIGSILGVLAFLLLAAITVLALVFQRKRRGTG
YREQLQQYSSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFGEVRRG
RLQPRGRREQAVAIQALWAGGAENLQMTFLGQAAVLGQFQHPNILRLEGVVTKSRPLMVL
TELMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLASFAFVHRALSAHSVLVNSHL
VCKVARLGHGPQVPGCLLRWAAPEVILHGKHSTASDVWSFGVMMWEVMSYGERPYWDMSD
QEVLTAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRAQRPHFDQLVAAFDKMIRKPDTLQA
AGAPGEDRPSQALLNPVTLDFLSLDSPQAWLSAIGLDCYRDNFAKSGLCTFSDVAQLSLE
DLPTLGITLAGHQKKLLHNVQLLQQHLRPPGSIEVALGRT
Download sequence
Identical sequences ENSEEUP00000007857 ENSEEUP00000007857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]