SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008022 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008022
Domain Number 1 Region: 52-167
Classification Level Classification E-value
Superfamily EF-hand 1.52e-18
Family Calmodulin-like 0.0044
Further Details:      
 
Domain Number 2 Region: 406-468
Classification Level Classification E-value
Superfamily EF-hand 0.00000562
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008022   Gene: ENSEEUG00000008795   Transcript: ENSEEUT00000008808
Sequence length 605
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_8625:3565:69827:1 gene:ENSEEUG00000008795 transcript:ENSEEUT00000008808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAISPGSDATFSSQRSDISEGARTKKCLPTEEEIFYINCRAAYLTVFKSSLENIISKDQL
YLALQHAGRNPSRKTINKYWTPQTAKLNFDDFCIILKKEKPTSKAELLKSFKQLDVNDDG
SILHSDLYKFLTKRGEKMTREEVNAVINLAGVNADGRFPSMKFCKLYMTTSEQCLKTTLE
KLEVDGKLRRQQFGSHTRGSSEKDRSLPLPKPSPRIIRKTDQETFSDKGDTRNHSLGTTR
KFKTSVSFTIIMGANSNRNSKLTEPNSIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKPSPWLSVDTALYILKENESQADLQLICFTELRNREVFGWTGE
LGPGVYCLNPSTGCWLRKEIKPTTEEAQLVCRDETGELCLTKEFRSTLSDIFDIIDLDGN
GLLSLEEYNFFELRTSGEKCDEDAWAVCKENFDTKKNELTRQGFLDLNLMEANDREGDPR
DLWVTLHSMGYSKALELTEACPFVIDVYADKCRPRIKAVHMEACSGQLEKIICKSVLNKG
DTKVMDGYENIVIHTDKRDTWITSVIENKTDNKVIIHVNNELSRNCINNRGLNIFAVEVA
PKSTM
Download sequence
Identical sequences ENSEEUP00000008022 ENSEEUP00000008022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]