SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008291 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008291
Domain Number 1 Region: 56-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.74e-29
Family G proteins 0.03
Further Details:      
 
Domain Number 2 Region: 446-534
Classification Level Classification E-value
Superfamily EF-hand 2.53e-21
Family Eps15 homology domain (EH domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008291   Gene: ENSEEUG00000009114   Transcript: ENSEEUT00000009099
Sequence length 541
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7241:30095:101893:-1 gene:ENSEEUG00000009114 transcript:ENSEEUT00000009099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSWMGRQAGGRERMGGADAVQTVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFEN
KPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGDTEGNTPGNALVVD
PKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQW
FAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALM
WSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDL
IKRARLAKVHAYIISHLKKEMPSMFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVK
AMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISSLMNLISQEEINVPTQLVQGGAFDGT
AEGPFNQGYGEGAKEGADEEEWVVARDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLP
NSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPSHLVPPSHRKSLPKT
D
Download sequence
Identical sequences A0A1S3AKV8
XP_007536541.1.11023 ENSEEUP00000008291 ENSEEUP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]