SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008306 from Erinaceus europaeus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008306
Domain Number 1 Region: 51-122
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000763
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008306   Gene: ENSEEUG00000009096   Transcript: ENSEEUT00000009114
Sequence length 437
Comment pep:known_by_projection genescaffold:HEDGEHOG:GeneScaffold_7090:42235:112148:1 gene:ENSEEUG00000009096 transcript:ENSEEUT00000009114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSDIKAKFKLNPLAKVPSSHAKXXXXXXXXXXXXXXXXXXXXXXXXXXXFQNAYNFFN
KDKTGCIDLHGMMCTLAKLGMSLTKHDVYNELRYADIDRDGKVNFSDFINVLTDKSRFLK
AVVPEKETCFNLPGNPGILLFEILSKLVETSALPRKAIMEIVSYFRRRLQDTSPGILWSP
YAMEYGRRRFRVDVCTPPSSSTAAFANAARVTIMKERDLFRFLEKLKKCNSCSDSPYSKI
PIFPLFPDMDGVVMGKPFKDLHKLEMLRRKEPLNFFENYFFHKKDWKTQAADIKPIRPTS
GYPDEILAIDHLFKRKQNWTVADAAAIKPHXXXXXXXXXXXXXXXXXKEMLNLWRKIRGD
LIGIDSGNESFYDTFTYTWSWNVCQELLSPKDLRLYDAYMYRNSSRSSRYSSSSDTSDGD
AETGRKRKWKGFKGFQQ
Download sequence
Identical sequences ENSEEUP00000008306 ENSEEUP00000008306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]